SCOPe 2.06: Domain d4j88a_: 4j88 A:

Lineage for d4j88a_ (4j88 A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein Green fluorescent protein, GFP [54513] (4 species)

7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (177 PDB entries)
   Uniprot P42212

8. Domain d4j88a_: 4j88 A: [223619]
   automated match to d3ztfa_
   complexed with edo, so4, trs

Details for d4j88a_

PDB Entry: 4j88, 2.08 Å

PDB Description: Dark-state structure of sfGFP containing the unnatural amino acid p-azido-phenylalanine at residue 66

PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d4j88a_:

Sequence; same for both SEQRES and ATOM records:

>d4j88a_ d.22.1.1 (A:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
skgeelftgvvpilveldgdvnghkfsvrgegegdatngkltlkficttgklpvpwptlv
ttlxvqcfsrypdhmkrhdffksampegyvqertisfkddgtyktraevkfegdtlvnri
elkgidfkedgnilghkleynfnshnvyitadkqkngikanfkirhnvedgsvqladhyq
qntpigdgpvllpdnhylstqsvlskdpnekrdhmvllefvtaagith

Timeline for d4j88a_:

• d4j88a_ first appeared in SCOPe 2.03
  
• d4j88a_ appears in SCOPe 2.05
  
• d4j88a_ appears in SCOPe 2.07
  
• d4j88a_ appears in the current release, SCOPe 2.08