![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily) core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets duplication: consists of two structural repeats |
![]() | Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) ![]() binds to the transactivation domain of human p53 |
![]() | Family a.42.1.1: SWIB/MDM2 domain [47593] (5 proteins) Pfam PF02201 |
![]() | Protein MDM2 [47594] (2 species) |
![]() | Species African clawed frog (Xenopus laevis) [TaxId:8355] [47595] (12 PDB entries) Uniprot P56273 13-119 |
![]() | Domain d4j7da_: 4j7d A: [223617] automated match to d1ycqa_ complexed with i31, so4 |
PDB Entry: 4j7d (more details), 1.25 Å
SCOPe Domain Sequences for d4j7da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4j7da_ a.42.1.1 (A:) MDM2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} meklvqptplllsllksagaqketftmkevlyhlgqyimakqlydekqqhivhcsndplg elfgvqefsvkehrriyamisrnlvs
Timeline for d4j7da_: