Lineage for d4j74a_ (4j74 A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1270168Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
    core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
    duplication: consists of two structural repeats
  4. 1270169Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) (S)
    binds to the transactivation domain of human p53
  5. 1270170Family a.42.1.1: SWIB/MDM2 domain [47593] (4 proteins)
    Pfam PF02201
  6. 1270177Protein MDM2 [47594] (2 species)
  7. 1270178Species African clawed frog (Xenopus laevis) [TaxId:8355] [47595] (9 PDB entries)
    Uniprot P56273 13-119
  8. 1270180Domain d4j74a_: 4j74 A: [223616]
    automated match to d1ycqa_
    complexed with i18, so4

Details for d4j74a_

PDB Entry: 4j74 (more details), 1.2 Å

PDB Description: The 1.2A crystal structure of humanized Xenopus MDM2 with RO0503918 - a nutlin fragment
PDB Compounds: (A:) E3 ubiquitin-protein ligase Mdm2

SCOPe Domain Sequences for d4j74a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j74a_ a.42.1.1 (A:) MDM2 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
meklvqptplllsllksagaqketftmkevlyhlgqyimakqlydekqqhivhcsndplg
elfgvqefsvkehrriyamisrnlvs

SCOPe Domain Coordinates for d4j74a_:

Click to download the PDB-style file with coordinates for d4j74a_.
(The format of our PDB-style files is described here.)

Timeline for d4j74a_: