Lineage for d4j6ye_ (4j6y E:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2057136Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2057137Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2057429Family b.38.1.2: Pleiotropic translational regulator Hfq [74939] (2 proteins)
    forms homohexameric ring structures
  6. 2057430Protein Pleiotropic translational regulator Hfq [74940] (3 species)
  7. 2057438Species Pseudomonas aeruginosa [TaxId:287] [141293] (11 PDB entries)
    Uniprot Q9HUM0 6-71
  8. 2057468Domain d4j6ye_: 4j6y E: [223614]
    automated match to d1u1te_
    complexed with cd

Details for d4j6ye_

PDB Entry: 4j6y (more details), 2.14 Å

PDB Description: Hfq from Pseudomonas aeruginosa crystallized in GTP presence
PDB Compounds: (E:) Protein hfq

SCOPe Domain Sequences for d4j6ye_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j6ye_ b.38.1.2 (E:) Pleiotropic translational regulator Hfq {Pseudomonas aeruginosa [TaxId: 287]}
ghslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvv
psrpvrl

SCOPe Domain Coordinates for d4j6ye_:

Click to download the PDB-style file with coordinates for d4j6ye_.
(The format of our PDB-style files is described here.)

Timeline for d4j6ye_: