SCOPe 2.08: Domain d1do6a_: 1do6 A:

Lineage for d1do6a_ (1do6 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.13: Superoxide reductase-like [49367] (2 families)

5. Family b.1.13.1: Superoxide reductase-like [49368] (3 proteins)
   binds iron in the site that is topologically equivalent to the copper-binding site of cupredoxins
   automatically mapped to Pfam PF01880

6. Protein Superoxide reductase (SOR) [49369] (1 species)

7. Species Pyrococcus furiosus [TaxId:2261] [49370] (3 PDB entries)

8. Domain d1do6a_: 1do6 A: [22361]
   complexed with fe

Details for d1do6a_

PDB Entry: 1do6, 2 Å

PDB Description: crystal structure of superoxide reductase in the oxidized state at 2.0 angstrom resolution

PDB Compounds: (A:) superoxide reductase

SCOPe Domain Sequences for d1do6a_:

Sequence; same for both SEQRES and ATOM records:

>d1do6a_ b.1.13.1 (A:) Superoxide reductase (SOR) {Pyrococcus furiosus [TaxId: 2261]}
misetirsgdwkgekhvpvieyeregelvkvkvqvgkeiphpnttehhiryielyflpeg
enfvyqvgrveftahgesvngpntsdvytepiayfvlktkkkgklyalsycnihglwene
vtle

Timeline for d1do6a_:

• d1do6a_ first appeared (with stable ids) in SCOP 1.55
  
• d1do6a_ appears in SCOPe 2.07