![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.13: Superoxide reductase-like [49367] (2 families) ![]() |
![]() | Family b.1.13.1: Superoxide reductase-like [49368] (3 proteins) binds iron in the site that is topologically equivalent to the copper-binding site of cupredoxins automatically mapped to Pfam PF01880 |
![]() | Protein Superoxide reductase (SOR) [49369] (1 species) |
![]() | Species Pyrococcus furiosus [TaxId:2261] [49370] (3 PDB entries) |
![]() | Domain d1do6a_: 1do6 A: [22361] complexed with fe |
PDB Entry: 1do6 (more details), 2 Å
SCOPe Domain Sequences for d1do6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1do6a_ b.1.13.1 (A:) Superoxide reductase (SOR) {Pyrococcus furiosus [TaxId: 2261]} misetirsgdwkgekhvpvieyeregelvkvkvqvgkeiphpnttehhiryielyflpeg enfvyqvgrveftahgesvngpntsdvytepiayfvlktkkkgklyalsycnihglwene vtle
Timeline for d1do6a_: