Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
Protein Low affinity immunoglobulin epsilon Fc receptor [143957] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [143958] (10 PDB entries) Uniprot P06734 156-298 |
Domain d4j6qa_: 4j6q A: [223595] automated match to d1t8ca1 |
PDB Entry: 4j6q (more details), 2.54 Å
SCOPe Domain Sequences for d4j6qa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4j6qa_ d.169.1.1 (A:) Low affinity immunoglobulin epsilon Fc receptor {Human (Homo sapiens) [TaxId: 9606]} fvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhasht gswiglrnldlkgefiwvdgshvdysnwapgeptsrsqgedcvmmrgsgrwndafcdrkl gawvcdrlatct
Timeline for d4j6qa_: