| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
| Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
| Protein Low affinity immunoglobulin epsilon Fc receptor [143957] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [143958] (10 PDB entries) Uniprot P06734 156-298 |
| Domain d4j6me_: 4j6m E: [223585] automated match to d1t8ca1 complexed with so4 |
PDB Entry: 4j6m (more details), 2.48 Å
SCOPe Domain Sequences for d4j6me_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4j6me_ d.169.1.1 (E:) Low affinity immunoglobulin epsilon Fc receptor {Human (Homo sapiens) [TaxId: 9606]}
gfvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhash
tgswiglrnldlkgefiwvdgshvdysnwapgeptsrsqgedcvmmrgsgrwndafcdrk
lgawvcdrlatctp
Timeline for d4j6me_: