SCOPe 2.06: Domain d4j6jb_: 4j6j B:

Lineage for d4j6jb_ (4j6j B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein Low affinity immunoglobulin epsilon Fc receptor [143957] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [143958] (12 PDB entries)
   Uniprot P06734 156-298

8. Domain d4j6jb_: 4j6j B: [223570]
   automated match to d1t8ca1
   complexed with so4

Details for d4j6jb_

PDB Entry: 4j6j, 1.9 Å

PDB Description: crystal structure of calcium2+-free wild-type cd23 lectin domain (crystal form a)

PDB Compounds: (B:) Low affinity immunoglobulin epsilon Fc receptor

SCOPe Domain Sequences for d4j6jb_:

Sequence; same for both SEQRES and ATOM records:

>d4j6jb_ d.169.1.1 (B:) Low affinity immunoglobulin epsilon Fc receptor {Human (Homo sapiens) [TaxId: 9606]}
gfvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhash
tgswiglrnldlkgefiwvdgshvdysnwapgeptsrsqgedcvmmrgsgrwndafcdrk
lgawvcdrlatctpp

Timeline for d4j6jb_:

• d4j6jb_ first appeared in SCOPe 2.03
  
• d4j6jb_ appears in SCOPe 2.05
  
• d4j6jb_ appears in SCOPe 2.07
  
• d4j6jb_ appears in the current release, SCOPe 2.08