Lineage for d1dqia_ (1dqi A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2374770Superfamily b.1.13: Superoxide reductase-like [49367] (2 families) (S)
  5. 2374771Family b.1.13.1: Superoxide reductase-like [49368] (3 proteins)
    binds iron in the site that is topologically equivalent to the copper-binding site of cupredoxins
    automatically mapped to Pfam PF01880
  6. 2374782Protein Superoxide reductase (SOR) [49369] (1 species)
  7. 2374783Species Pyrococcus furiosus [TaxId:2261] [49370] (3 PDB entries)
  8. 2374784Domain d1dqia_: 1dqi A: [22357]
    complexed with fe

Details for d1dqia_

PDB Entry: 1dqi (more details), 1.7 Å

PDB Description: crystal structure of superoxide reductase from p. furiosus in the oxidized state at 1.7 angstroms resolution
PDB Compounds: (A:) superoxide reductase

SCOPe Domain Sequences for d1dqia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dqia_ b.1.13.1 (A:) Superoxide reductase (SOR) {Pyrococcus furiosus [TaxId: 2261]}
misetirsgdwkgekhvpvieyeregelvkvkvqvgkeiphpnttehhiryielyflpeg
enfvyqvgrveftahgesvngpntsdvytepiayfvlktkkkgklyalsycnihglwene
vtle

SCOPe Domain Coordinates for d1dqia_:

Click to download the PDB-style file with coordinates for d1dqia_.
(The format of our PDB-style files is described here.)

Timeline for d1dqia_: