SCOPe 2.08: Domain d4j5wc1: 4j5w C:227-457

Lineage for d4j5wc1 (4j5w C:227-457)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.0: automated matches [191623] (1 protein)
   not a true family

6. Protein automated matches [191142] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189274] (121 PDB entries)

8. Domain d4j5wc1: 4j5w C:227-457 [223559]
   Other proteins in same PDB: d4j5wd_
   automated match to d1r1ka_
   complexed with mg

Details for d4j5wc1

PDB Entry: 4j5w, 2.8 Å

PDB Description: crystal structure of the apo-pxr/rxralpha lbd heterotetramer complex

PDB Compounds: (C:) Retinoic acid receptor RXR-alpha, Nuclear receptor coactivator 1

SCOPe Domain Sequences for d4j5wc1:

Sequence, based on SEQRES records:

>d4j5wc1 a.123.1.0 (C:227-457) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakri
phfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaif
drvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckh
kypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemlea

Sequence, based on observed residues (ATOM records):

>d4j5wc1 a.123.1.0 (C:227-457) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nedmpverileaelavepkpndpvtnicqaadkqlftlvewakriphfselplddqvill
ragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaifdrvltelvskmrdmq
mdktelgclraivlfnpdskglsnpaevealrekvyasleayckhkypeqpgrfaklllr
lpalrsiglkclehlfffkligdtpidtflmemlea

Timeline for d4j5wc1:

• d4j5wc1 first appeared in SCOPe 2.03
  
• d4j5wc1 appears in SCOPe 2.07