Lineage for d4j5wc1 (4j5w C:227-457)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2729960Family a.123.1.0: automated matches [191623] (1 protein)
    not a true family
  6. 2729961Protein automated matches [191142] (5 species)
    not a true protein
  7. 2729974Species Human (Homo sapiens) [TaxId:9606] [189274] (121 PDB entries)
  8. 2730168Domain d4j5wc1: 4j5w C:227-457 [223559]
    Other proteins in same PDB: d4j5wd_
    automated match to d1r1ka_
    complexed with mg

Details for d4j5wc1

PDB Entry: 4j5w (more details), 2.8 Å

PDB Description: crystal structure of the apo-pxr/rxralpha lbd heterotetramer complex
PDB Compounds: (C:) Retinoic acid receptor RXR-alpha, Nuclear receptor coactivator 1

SCOPe Domain Sequences for d4j5wc1:

Sequence, based on SEQRES records: (download)

>d4j5wc1 a.123.1.0 (C:227-457) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakri
phfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaif
drvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckh
kypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemlea

Sequence, based on observed residues (ATOM records): (download)

>d4j5wc1 a.123.1.0 (C:227-457) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nedmpverileaelavepkpndpvtnicqaadkqlftlvewakriphfselplddqvill
ragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaifdrvltelvskmrdmq
mdktelgclraivlfnpdskglsnpaevealrekvyasleayckhkypeqpgrfaklllr
lpalrsiglkclehlfffkligdtpidtflmemlea

SCOPe Domain Coordinates for d4j5wc1:

Click to download the PDB-style file with coordinates for d4j5wc1.
(The format of our PDB-style files is described here.)

Timeline for d4j5wc1: