![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
![]() | Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) ![]() |
![]() | Family a.123.1.0: automated matches [191623] (1 protein) not a true family |
![]() | Protein automated matches [191142] (5 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189274] (121 PDB entries) |
![]() | Domain d4j5wc1: 4j5w C:227-457 [223559] Other proteins in same PDB: d4j5wd_ automated match to d1r1ka_ complexed with mg |
PDB Entry: 4j5w (more details), 2.8 Å
SCOPe Domain Sequences for d4j5wc1:
Sequence, based on SEQRES records: (download)
>d4j5wc1 a.123.1.0 (C:227-457) automated matches {Human (Homo sapiens) [TaxId: 9606]} nedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakri phfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaif drvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckh kypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemlea
>d4j5wc1 a.123.1.0 (C:227-457) automated matches {Human (Homo sapiens) [TaxId: 9606]} nedmpverileaelavepkpndpvtnicqaadkqlftlvewakriphfselplddqvill ragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaifdrvltelvskmrdmq mdktelgclraivlfnpdskglsnpaevealrekvyasleayckhkypeqpgrfaklllr lpalrsiglkclehlfffkligdtpidtflmemlea
Timeline for d4j5wc1: