Lineage for d4j4ma_ (4j4m A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1423492Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1423493Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1424465Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 1424466Protein automated matches [190805] (8 species)
    not a true protein
  7. 1424509Species Protobothrops mucrosquamatus [TaxId:103944] [226718] (1 PDB entry)
  8. 1424510Domain d4j4ma_: 4j4m A: [223551]
    automated match to d1r54a_
    complexed with zn

Details for d4j4ma_

PDB Entry: 4j4m (more details), 1.8 Å

PDB Description: Crystal structure of TM-1, a Trimeresurus mucrosquamatus venom metalloproteinase
PDB Compounds: (A:) zinc-dependent metalloproteinase

SCOPe Domain Sequences for d4j4ma_:

Sequence, based on SEQRES records: (download)

>d4j4ma_ d.92.1.0 (A:) automated matches {Protobothrops mucrosquamatus [TaxId: 103944]}
rfpqryvmlaivadhgmvtkysgnssaittrvhqmvshvtemysplniattlsllriwss
kdlitvqsdssvtlgsfgdwrkvvllsqqahdcaflntatalddstiglaysngmcdpkf
svglvqdhssnvfmvavtmthelghnlgmahdeaggcacsscimspaassgpsklfsdcs
kddyqtfltntnpqcilnap

Sequence, based on observed residues (ATOM records): (download)

>d4j4ma_ d.92.1.0 (A:) automated matches {Protobothrops mucrosquamatus [TaxId: 103944]}
rfpqryvmlaivadhgmvtkysgnssaittrvhqmvshvtemysplniattlsllriwss
kdlitvqsdssvtlgsfgdwrkvvllsqqahdcaflntatalddstiglaysngmcdpkf
svglvqdhssnvfmvavtmthelghnlgmahdecsscimspaassgpsklfsdcskddyq
tfltntnpqcilnap

SCOPe Domain Coordinates for d4j4ma_:

Click to download the PDB-style file with coordinates for d4j4ma_.
(The format of our PDB-style files is described here.)

Timeline for d4j4ma_: