![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) ![]() |
![]() | Family d.92.1.0: automated matches [191495] (1 protein) not a true family |
![]() | Protein automated matches [190805] (20 species) not a true protein |
![]() | Species Protobothrops mucrosquamatus [TaxId:103944] [226718] (1 PDB entry) |
![]() | Domain d4j4ma_: 4j4m A: [223551] automated match to d1r54a_ complexed with zn |
PDB Entry: 4j4m (more details), 1.8 Å
SCOPe Domain Sequences for d4j4ma_:
Sequence, based on SEQRES records: (download)
>d4j4ma_ d.92.1.0 (A:) automated matches {Protobothrops mucrosquamatus [TaxId: 103944]} rfpqryvmlaivadhgmvtkysgnssaittrvhqmvshvtemysplniattlsllriwss kdlitvqsdssvtlgsfgdwrkvvllsqqahdcaflntatalddstiglaysngmcdpkf svglvqdhssnvfmvavtmthelghnlgmahdeaggcacsscimspaassgpsklfsdcs kddyqtfltntnpqcilnap
>d4j4ma_ d.92.1.0 (A:) automated matches {Protobothrops mucrosquamatus [TaxId: 103944]} rfpqryvmlaivadhgmvtkysgnssaittrvhqmvshvtemysplniattlsllriwss kdlitvqsdssvtlgsfgdwrkvvllsqqahdcaflntatalddstiglaysngmcdpkf svglvqdhssnvfmvavtmthelghnlgmahdecsscimspaassgpsklfsdcskddyq tfltntnpqcilnap
Timeline for d4j4ma_: