Lineage for d4j4fa_ (4j4f A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1810256Fold b.89: Cyanovirin-N [51321] (1 superfamily)
    complex fold
  4. 1810257Superfamily b.89.1: Cyanovirin-N [51322] (2 families) (S)
    duplication: tandem repeat of two homologous motifs made three stranded beta-sheet and beta-hairpins
    automatically mapped to Pfam PF08881
  5. 1810258Family b.89.1.1: Cyanovirin-N [51323] (2 proteins)
  6. 1810259Protein Cyanovirin-N [51324] (1 species)
  7. 1810260Species Nostoc ellipsosporum [TaxId:45916] [51325] (16 PDB entries)
  8. 1810268Domain d4j4fa_: 4j4f A: [223547]
    automated match to d4j4db_

Details for d4j4fa_

PDB Entry: 4j4f (more details), 1.9 Å

PDB Description: Structure of P51G Cyanovirin-N swapped tetramer in the P212121 space group
PDB Compounds: (A:) Cyanovirin-N

SCOPe Domain Sequences for d4j4fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j4fa_ b.89.1.1 (A:) Cyanovirin-N {Nostoc ellipsosporum [TaxId: 45916]}
lgkfsqtcynsaiqgsvltstcertnggyntssidlnsvienvdgslkwqgsnfietcrn
tqlagsselaaecktraqqfvstkinlddhianidgtlkye

SCOPe Domain Coordinates for d4j4fa_:

Click to download the PDB-style file with coordinates for d4j4fa_.
(The format of our PDB-style files is described here.)

Timeline for d4j4fa_: