Lineage for d3kbpb1 (3kbp B:9-120)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1769910Superfamily b.1.12: Purple acid phosphatase, N-terminal domain [49363] (2 families) (S)
  5. 1769911Family b.1.12.1: Purple acid phosphatase, N-terminal domain [49364] (1 protein)
  6. 1769912Protein Purple acid phosphatase, N-terminal domain [49365] (2 species)
  7. Species French bean (Phaseolus vulgaris) [TaxId:3885] [49366] (3 PDB entries)
  8. 1769923Domain d3kbpb1: 3kbp B:9-120 [22354]
    Other proteins in same PDB: d3kbpa2, d3kbpb2, d3kbpc2, d3kbpd2
    complexed with fe, nag, wo4, zn

Details for d3kbpb1

PDB Entry: 3kbp (more details), 3 Å

PDB Description: kidney bean purple acid phosphatase
PDB Compounds: (B:) purple acid phosphatase

SCOPe Domain Sequences for d3kbpb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kbpb1 b.1.12.1 (B:9-120) Purple acid phosphatase, N-terminal domain {French bean (Phaseolus vulgaris) [TaxId: 3885]}
rdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrkr
iakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitpp

SCOPe Domain Coordinates for d3kbpb1:

Click to download the PDB-style file with coordinates for d3kbpb1.
(The format of our PDB-style files is described here.)

Timeline for d3kbpb1: