| Class b: All beta proteins [48724] (176 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.12: Purple acid phosphatase, N-terminal domain [49363] (2 families) ![]() |
| Family b.1.12.1: Purple acid phosphatase, N-terminal domain [49364] (1 protein) |
| Protein Purple acid phosphatase, N-terminal domain [49365] (2 species) |
| Domain d3kbpb1: 3kbp B:9-120 [22354] Other proteins in same PDB: d3kbpa2, d3kbpb2, d3kbpc2, d3kbpd2 complexed with fe, nag, wo4, zn |
PDB Entry: 3kbp (more details), 3 Å
SCOPe Domain Sequences for d3kbpb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kbpb1 b.1.12.1 (B:9-120) Purple acid phosphatase, N-terminal domain {French bean (Phaseolus vulgaris) [TaxId: 3885]}
rdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrkr
iakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitpp
Timeline for d3kbpb1: