Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.12: Purple acid phosphatase, N-terminal domain [49363] (1 family) |
Family b.1.12.1: Purple acid phosphatase, N-terminal domain [49364] (1 protein) |
Protein Purple acid phosphatase, N-terminal domain [49365] (2 species) |
Species Kidney bean (Phaseolus vulgaris) [TaxId:3885] [49366] (5 PDB entries) |
Domain d3kbpb1: 3kbp B:9-120 [22354] Other proteins in same PDB: d3kbpa2, d3kbpb2, d3kbpc2, d3kbpd2 |
PDB Entry: 3kbp (more details), 3 Å
SCOP Domain Sequences for d3kbpb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kbpb1 b.1.12.1 (B:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} rdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrkr iakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitpp
Timeline for d3kbpb1: