![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
![]() | Protein automated matches [226831] (73 species) not a true protein |
![]() | Species Castor bean (Ricinus communis) [TaxId:3988] [226602] (1 PDB entry) |
![]() | Domain d4j2fa2: 4j2f A:83-220 [223535] Other proteins in same PDB: d4j2fa1 automated match to d1gwca1 complexed with gol |
PDB Entry: 4j2f (more details), 1.9 Å
SCOPe Domain Sequences for d4j2fa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4j2fa2 a.45.1.0 (A:83-220) automated matches {Castor bean (Ricinus communis) [TaxId: 3988]} llpsdpheravarfwvkfiedkgtaiwnifrtkgeelekavknclevlktieehamgvsd dkyfggdkigivdiafcgiahwlgvieevagvkvlesqkfprlhawtenfkeapiikenl pdrdqmtaffkrrremil
Timeline for d4j2fa2: