Lineage for d4j1wc1 (4j1w C:5-76)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1995687Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 1995688Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 1995785Family a.35.1.3: SinR domain-like [47432] (9 proteins)
  6. 1995796Protein Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain [140516] (1 species)
  7. 1995797Species Streptomyces wedmorensis [TaxId:43759] [140517] (14 PDB entries)
    Uniprot Q56185 6-76
  8. 1995822Domain d4j1wc1: 4j1w C:5-76 [223532]
    Other proteins in same PDB: d4j1wa2, d4j1wb2, d4j1wc2
    automated match to d1zz6a1
    complexed with fe2, ffq, gol

Details for d4j1wc1

PDB Entry: 4j1w (more details), 2.72 Å

PDB Description: Crystal Structure of Fe(II)-HppE with alternative substrate (R)-1-HPP
PDB Compounds: (C:) epoxidase

SCOPe Domain Sequences for d4j1wc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j1wc1 a.35.1.3 (C:5-76) Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain {Streptomyces wedmorensis [TaxId: 43759]}
ktastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriahvlg
tsigaltppagn

SCOPe Domain Coordinates for d4j1wc1:

Click to download the PDB-style file with coordinates for d4j1wc1.
(The format of our PDB-style files is described here.)

Timeline for d4j1wc1: