![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
![]() | Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) ![]() |
![]() | Family a.35.1.3: SinR domain-like [47432] (9 proteins) |
![]() | Protein Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain [140516] (1 species) |
![]() | Species Streptomyces wedmorensis [TaxId:43759] [140517] (14 PDB entries) Uniprot Q56185 6-76 |
![]() | Domain d4j1wc1: 4j1w C:5-76 [223532] Other proteins in same PDB: d4j1wa2, d4j1wb2, d4j1wc2 automated match to d1zz6a1 complexed with fe2, ffq, gol |
PDB Entry: 4j1w (more details), 2.72 Å
SCOPe Domain Sequences for d4j1wc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4j1wc1 a.35.1.3 (C:5-76) Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain {Streptomyces wedmorensis [TaxId: 43759]} ktastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriahvlg tsigaltppagn
Timeline for d4j1wc1:
![]() Domains from other chains: (mouse over for more information) d4j1wa1, d4j1wa2, d4j1wb1, d4j1wb2 |