SCOPe 2.07: Domain d4j1wb1: 4j1w B:5-76

Lineage for d4j1wb1 (4j1w B:5-76)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.3: SinR domain-like [47432] (9 proteins)

6. Protein Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain [140516] (1 species)

7. Species Streptomyces wedmorensis [TaxId:43759] [140517] (14 PDB entries)
   Uniprot Q56185 6-76

8. Domain d4j1wb1: 4j1w B:5-76 [223530]
   Other proteins in same PDB: d4j1wa2, d4j1wb2, d4j1wc2
   automated match to d1zz6a1
   complexed with fe2, ffq, gol

Details for d4j1wb1

PDB Entry: 4j1w, 2.72 Å

PDB Description: Crystal Structure of Fe(II)-HppE with alternative substrate (R)-1-HPP

PDB Compounds: (B:) epoxidase

SCOPe Domain Sequences for d4j1wb1:

Sequence; same for both SEQRES and ATOM records:

>d4j1wb1 a.35.1.3 (B:5-76) Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain {Streptomyces wedmorensis [TaxId: 43759]}
ktastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriahvlg
tsigaltppagn

Timeline for d4j1wb1:

• d4j1wb1 first appeared in SCOPe 2.03
  
• d4j1wb1 appears in SCOPe 2.06
  
• d4j1wb1 appears in the current release, SCOPe 2.08