![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.12: Purple acid phosphatase, N-terminal domain [49363] (2 families) ![]() |
![]() | Family b.1.12.1: Purple acid phosphatase, N-terminal domain [49364] (1 protein) |
![]() | Protein Purple acid phosphatase, N-terminal domain [49365] (2 species) |
![]() | Domain d3kbpa1: 3kbp A:9-120 [22353] Other proteins in same PDB: d3kbpa2, d3kbpb2, d3kbpc2, d3kbpd2 complexed with fe, nag, wo4, zn |
PDB Entry: 3kbp (more details), 3 Å
SCOPe Domain Sequences for d3kbpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kbpa1 b.1.12.1 (A:9-120) Purple acid phosphatase, N-terminal domain {French bean (Phaseolus vulgaris) [TaxId: 3885]} rdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrkr iakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitpp
Timeline for d3kbpa1: