![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.1: RmlC-like cupins [51182] (25 families) ![]() |
![]() | Family b.82.1.10: TM1459-like [101976] (3 proteins) |
![]() | Protein Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain [141593] (1 species) |
![]() | Species Streptomyces wedmorensis [TaxId:43759] [141594] (14 PDB entries) Uniprot Q56185 77-198 |
![]() | Domain d4j1wa2: 4j1w A:77-198 [223529] Other proteins in same PDB: d4j1wa1, d4j1wb1, d4j1wc1 automated match to d1zz6a2 complexed with fe2, ffq, gol |
PDB Entry: 4j1w (more details), 2.72 Å
SCOPe Domain Sequences for d4j1wa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4j1wa2 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]} dlddgviiqmpderpilkgvrdnvdyyvynclvrtkrapslvplvvdvltdnpddakfns ghagneflfvlegeihmkwgdkenpkeallptgasmfveehvphaftaakgtgsakliav nf
Timeline for d4j1wa2:
![]() Domains from other chains: (mouse over for more information) d4j1wb1, d4j1wb2, d4j1wc1, d4j1wc2 |