Lineage for d4j1uc2 (4j1u C:113-216)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1294263Protein automated matches [190374] (12 species)
    not a true protein
  7. 1294862Species Mouse (Mus musculus) [TaxId:10090] [224855] (237 PDB entries)
  8. 1295157Domain d4j1uc2: 4j1u C:113-216 [223525]
    Other proteins in same PDB: d4j1ua1, d4j1uc1, d4j1ue1
    automated match to d1rhha2

Details for d4j1uc2

PDB Entry: 4j1u (more details), 2.58 Å

PDB Description: Crystal structure of antibody 93F3 unstable variant
PDB Compounds: (C:) antibody 93F3 Light chain

SCOPe Domain Sequences for d4j1uc2:

Sequence, based on SEQRES records: (download)

>d4j1uc2 b.1.1.2 (C:113-216) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rsvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Sequence, based on observed residues (ATOM records): (download)

>d4j1uc2 b.1.1.2 (C:113-216) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rsvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhacevthqglsspvtksfnr

SCOPe Domain Coordinates for d4j1uc2:

Click to download the PDB-style file with coordinates for d4j1uc2.
(The format of our PDB-style files is described here.)

Timeline for d4j1uc2: