SCOPe 2.08: Domain d4j1uc2: 4j1u C:113-216

Lineage for d4j1uc2 (4j1u C:113-216)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d4j1uc2: 4j1u C:113-216 [223525]
   Other proteins in same PDB: d4j1ua1, d4j1uc1, d4j1ue1
   automated match to d1rhha2

Details for d4j1uc2

PDB Entry: 4j1u, 2.58 Å

PDB Description: Crystal structure of antibody 93F3 unstable variant

PDB Compounds: (C:) antibody 93F3 Light chain

SCOPe Domain Sequences for d4j1uc2:

Sequence, based on SEQRES records:

>d4j1uc2 b.1.1.2 (C:113-216) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rsvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Sequence, based on observed residues (ATOM records):

>d4j1uc2 b.1.1.2 (C:113-216) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rsvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhacevthqglsspvtksfnr

Timeline for d4j1uc2:

• d4j1uc2 first appeared in SCOPe 2.03
  
• d4j1uc2 appears in SCOPe 2.07