Lineage for d4j15b1 (4j15 B:21-152)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398897Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2400006Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 2400007Protein automated matches [190576] (50 species)
    not a true protein
  7. 2400092Species Human (Homo sapiens) [TaxId:9606] [225402] (14 PDB entries)
  8. 2400096Domain d4j15b1: 4j15 B:21-152 [223511]
    Other proteins in same PDB: d4j15a2, d4j15b2
    automated match to d1asza1
    protein/RNA complex; complexed with gol

Details for d4j15b1

PDB Entry: 4j15 (more details), 2.24 Å

PDB Description: Crystal structure of human cytosolic aspartyl-tRNA synthetase, a component of multi-tRNA synthetase complex
PDB Compounds: (B:) Aspartate--tRNA ligase, cytoplasmic

SCOPe Domain Sequences for d4j15b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j15b1 b.40.4.0 (B:21-152) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aedyakerygissmiqsqekpdrvlvrvrdltiqkadevvwvrarvhtsrakgkqcflvl
rqqqfnvqalvavgdhaskqmvkfaaninkesivdvegvvrkvnqkigsctqqdvelhvq
kiyvislaeprl

SCOPe Domain Coordinates for d4j15b1:

Click to download the PDB-style file with coordinates for d4j15b1.
(The format of our PDB-style files is described here.)

Timeline for d4j15b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4j15b2