Lineage for d4j15a2 (4j15 A:153-495)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1663707Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 1663708Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 1664082Family d.104.1.0: automated matches [227172] (1 protein)
    not a true family
  6. 1664083Protein automated matches [226887] (8 species)
    not a true protein
  7. 1664096Species Human (Homo sapiens) [TaxId:9606] [225403] (4 PDB entries)
  8. 1664097Domain d4j15a2: 4j15 A:153-495 [223510]
    Other proteins in same PDB: d4j15a1, d4j15b1
    automated match to d1eova2
    protein/RNA complex; complexed with gol

Details for d4j15a2

PDB Entry: 4j15 (more details), 2.24 Å

PDB Description: Crystal structure of human cytosolic aspartyl-tRNA synthetase, a component of multi-tRNA synthetase complex
PDB Compounds: (A:) Aspartate--tRNA ligase, cytoplasmic

SCOPe Domain Sequences for d4j15a2:

Sequence, based on SEQRES records: (download)

>d4j15a2 d.104.1.0 (A:153-495) automated matches {Human (Homo sapiens) [TaxId: 9606]}
plqlddavrpeaegeeegratvnqdtrldnrvidlrtstsqavfrlqsgichlfretlin
kgfveiqtpkiisaasegganvftvsyfknnaylaqspqlykqmcicadfekvfsigpvf
raedsnthrhltefvgldiemafnyhyhevmeeiadtmvqifkglqerfqteiqtvnkqf
pcepfkfleptlrleycealamlreagvemgdeddlstpnekllghlvkekydtdfyild
kyplavrpfytmpdprnpkqsnsydmfmrgeeilsgaqrihdpqllteralhhgidleki
kayidsfrfgapphagggiglervtmlflglhnvrqtsmfprd

Sequence, based on observed residues (ATOM records): (download)

>d4j15a2 d.104.1.0 (A:153-495) automated matches {Human (Homo sapiens) [TaxId: 9606]}
plqlddavrptvnqdtrldnrvidlrtstsqavfrlqsgichlfretlinkgfveiqtpk
iqspqlykqmcicadfekvfsigpvfltefvgldiemafnyhyhevmeeiadtmvqifkg
lqerfqteiqtvnkqfpcepfkfleptlrleycealamlreagvemgdeddlstpnekll
ghlvkekydtdfyildkyplavrpfytmpdprnpkqsnsydmfmrgeeilsgaqrihdpq
llteralhhgidlekikayidsfrfgapphagggiglervtmlflglhnvrqtsmfprd

SCOPe Domain Coordinates for d4j15a2:

Click to download the PDB-style file with coordinates for d4j15a2.
(The format of our PDB-style files is described here.)

Timeline for d4j15a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4j15a1