Lineage for d4j12a2 (4j12 A:340-444)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2750061Domain d4j12a2: 4j12 A:340-444 [223508]
    automated match to d2ql1a2
    complexed with nag

Details for d4j12a2

PDB Entry: 4j12 (more details), 1.9 Å

PDB Description: monomeric fc
PDB Compounds: (A:) human Fc fragment

SCOPe Domain Sequences for d4j12a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j12a2 b.1.1.2 (A:340-444) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kgqprepqvytlppsreemtknqvnltclvkgfypsdiavewesngqpennykttppvld
sdgsfflnstltvdksrwqqgnvfscsvmhealhnhytqkslsls

SCOPe Domain Coordinates for d4j12a2:

Click to download the PDB-style file with coordinates for d4j12a2.
(The format of our PDB-style files is described here.)

Timeline for d4j12a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4j12a1