Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (17 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries) |
Domain d4j12a1: 4j12 A:236-339 [223507] automated match to d2ql1a1 complexed with nag |
PDB Entry: 4j12 (more details), 1.9 Å
SCOPe Domain Sequences for d4j12a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4j12a1 b.1.1.2 (A:236-339) automated matches {Human (Homo sapiens) [TaxId: 9606]} ggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq ynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiska
Timeline for d4j12a1: