SCOPe 2.07: Domain d4j03a1: 4j03 A:1-227

Lineage for d4j03a1 (4j03 A:1-227)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.2: YihX-like [56789] (3 proteins)
   the insertion subdomain is a 4-helical bundle
   automatically mapped to Pfam PF13419

6. Protein Epoxide hydrolase, N-terminal domain [56790] (2 species)
   has a lipid phosphatase activity

7. Species Human (Homo sapiens) [TaxId:9606] [102303] (36 PDB entries)

8. Domain d4j03a1: 4j03 A:1-227 [223494]
   Other proteins in same PDB: d4j03a2
   automated match to d1vj5a1
   complexed with fvs, mg, po4

Details for d4j03a1

PDB Entry: 4j03, 2.92 Å

PDB Description: Crystal structure of human soluble epoxide hydrolase complexed with fulvestrant

PDB Compounds: (A:) Bifunctional epoxide hydrolase 2

SCOPe Domain Sequences for d4j03a1:

Sequence; same for both SEQRES and ATOM records:

>d4j03a1 c.108.1.2 (A:1-227) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mtlraavfdldgvlalpavfgvlgrteealalprgllndafqkggpegattrlmkgeitl
sqwiplmeencrkcsetakvclpknfsikeifdkaisarkinrpmlqaalmlrkkgftta
iltntwlddraerdglaqlmcelkmhfdfliescqvgmvkpepqiykflldtlkaspsev
vflddiganlkpardlgmvtilvqdtdtalkelekvtgiqllntpap

Timeline for d4j03a1:

• d4j03a1 first appeared in SCOPe 2.03
  
• d4j03a1 appears in SCOPe 2.06
  
• d4j03a1 appears in the current release, SCOPe 2.08