SCOPe 2.04: Domain d4izcb_: 4izc B:

Lineage for d4izcb_ (4izc B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (46 species)
   not a true protein

7. Species Ruegeria pomeroyi [TaxId:246200] [226684] (3 PDB entries)

8. Domain d4izcb_: 4izc B: [223489]
   automated match to d2zqqa_
   complexed with 1gz

Details for d4izcb_

PDB Entry: 4izc, 1.8 Å

PDB Description: Crystal structure of DmdD E121A in complex with MTA-CoA

PDB Compounds: (B:) Enoyl-CoA hydratase/isomerase family protein

SCOPe Domain Sequences for d4izcb_:

Sequence; same for both SEQRES and ATOM records:

>d4izcb_ c.14.1.0 (B:) automated matches {Ruegeria pomeroyi [TaxId: 246200]}
tqdvtsgysnldldlrdngvcvvtlnrpdkrnaldvatieelvtffstahrkgvravvlt
gagdhfcagldlvehwkadrsaddfmhvclrwheafnkmeyggvpiiaalrgavvgggla
lasaahlrvmdqstyfalpegqrgiftgggatirvsdmigkyrmidmiltgrvyqgqeaa
dlglaqyitegssfdkameladkiasnlpltnfaicsaishmqnmsgldaayaeafvggi
vntqpaarerleafanktaarvrpns

Timeline for d4izcb_:

• d4izcb_ first appeared in SCOPe 2.03
  
• d4izcb_ appears in SCOPe 2.05
  
• d4izcb_ appears in the current release, SCOPe 2.08