SCOPe 2.03: Domain d4izba_: 4izb A:

Lineage for d4izba_ (4izb A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (42 species)
   not a true protein

7. Species Ruegeria pomeroyi [TaxId:246200] [226684] (3 PDB entries)

8. Domain d4izba_: 4izb A: [223486]
   automated match to d2zqqb_

Details for d4izba_

PDB Entry: 4izb, 1.5 Å

PDB Description: Crystal structure of DmdD, a crotonase superfamily enzyme that catalyzes the hydration and hydrolysis of methylthioacryloyl-CoA

PDB Compounds: (A:) Enoyl-CoA hydratase/isomerase family protein

SCOPe Domain Sequences for d4izba_:

Sequence; same for both SEQRES and ATOM records:

>d4izba_ c.14.1.0 (A:) automated matches {Ruegeria pomeroyi [TaxId: 246200]}
dvtsgysnldldlrdngvcvvtlnrpdkrnaldvatieelvtffstahrkgvravvltga
gdhfcagldlvehwkadrsaddfmhvclrwheafnkmeyggvpiiaalrgavvggglela
saahlrvmdqstyfalpegqrgiftgggatirvsdmigkyrmidmiltgrvyqgqeaadl
glaqyitegssfdkameladkiasnlpltnfaicsaishmqnmsgldaayaeafvggivn
tqpaa

Timeline for d4izba_:

• d4izba_ is new in SCOPe 2.03-stable
  
• d4izba_ appears in SCOPe 2.04
  
• d4izba_ appears in the current release, SCOPe 2.08