Lineage for d4iyqb_ (4iyq B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413688Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1414737Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 1414972Family d.58.5.0: automated matches [191474] (1 protein)
    not a true family
  6. 1414973Protein automated matches [190753] (7 species)
    not a true protein
  7. 1415015Species Ehrlichia chaffeensis [TaxId:205920] [226594] (1 PDB entry)
  8. 1415017Domain d4iyqb_: 4iyq B: [223482]
    automated match to d2zfha1
    complexed with ca

Details for d4iyqb_

PDB Entry: 4iyq (more details), 2.55 Å

PDB Description: Crystal structure of divalent ion tolerance protein CutA1 from Ehrlichia chaffeensis
PDB Compounds: (B:) Divalent ion tolerance protein CutA1

SCOPe Domain Sequences for d4iyqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iyqb_ d.58.5.0 (B:) automated matches {Ehrlichia chaffeensis [TaxId: 205920]}
smknisllytttptyedayrisnillenkliacanifsnitsvyvwedeihnntecaiil
kttndlvqhatnkiqaihpydtpaiitidptnandkfiqwvndctal

SCOPe Domain Coordinates for d4iyqb_:

Click to download the PDB-style file with coordinates for d4iyqb_.
(The format of our PDB-style files is described here.)

Timeline for d4iyqb_: