Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) form timeric structures with the orthogonally packed beta-sheets |
Family d.58.5.0: automated matches [191474] (1 protein) not a true family |
Protein automated matches [190753] (7 species) not a true protein |
Species Ehrlichia chaffeensis [TaxId:205920] [226594] (1 PDB entry) |
Domain d4iyqb_: 4iyq B: [223482] automated match to d2zfha1 complexed with ca |
PDB Entry: 4iyq (more details), 2.55 Å
SCOPe Domain Sequences for d4iyqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4iyqb_ d.58.5.0 (B:) automated matches {Ehrlichia chaffeensis [TaxId: 205920]} smknisllytttptyedayrisnillenkliacanifsnitsvyvwedeihnntecaiil kttndlvqhatnkiqaihpydtpaiitidptnandkfiqwvndctal
Timeline for d4iyqb_: