SCOPe 2.08: Domain d4iyqa1: 4iyq A:2-107

Lineage for d4iyqa1 (4iyq A:2-107)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.0: automated matches [191474] (1 protein)
   not a true family

6. Protein automated matches [190753] (21 species)
   not a true protein

7. Species Ehrlichia chaffeensis [TaxId:205920] [226594] (1 PDB entry)

8. Domain d4iyqa1: 4iyq A:2-107 [223481]
   Other proteins in same PDB: d4iyqa2, d4iyqb2, d4iyqc2
   automated match to d2zfha1
   complexed with ca

Details for d4iyqa1

PDB Entry: 4iyq, 2.55 Å

PDB Description: Crystal structure of divalent ion tolerance protein CutA1 from Ehrlichia chaffeensis

PDB Compounds: (A:) Divalent ion tolerance protein CutA1

SCOPe Domain Sequences for d4iyqa1:

Sequence; same for both SEQRES and ATOM records:

>d4iyqa1 d.58.5.0 (A:2-107) automated matches {Ehrlichia chaffeensis [TaxId: 205920]}
mknisllytttptyedayrisnillenkliacanifsnitsvyvwedeihnntecaiilk
ttndlvqhatnkiqaihpydtpaiitidptnandkfiqwvndctal

Timeline for d4iyqa1:

• d4iyqa1 first appeared in SCOPe 2.03, called d4iyqa_
  
• d4iyqa1 appears in SCOPe 2.07