SCOPe 2.06: Domain d4ixta_: 4ixt A:

Lineage for d4ixta_ (4ixt A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

6. Protein automated matches [190085] (51 species)
   not a true protein

7. Species Rhizobium radiobacter [TaxId:358] [197100] (3 PDB entries)

8. Domain d4ixta_: 4ixt A: [223471]
   automated match to d4ixwa_
   complexed with 1h1, cl; mutant

Details for d4ixta_

PDB Entry: 4ixt, 2.49 Å

PDB Description: structure of a 37-fold mutant of halohydrin dehalogenase (hhec) bound to ethyl (r)-4-cyano-3-hydroxybutyrate

PDB Compounds: (A:) halohydrin dehalogenase

SCOPe Domain Sequences for d4ixta_:

Sequence; same for both SEQRES and ATOM records:

>d4ixta_ c.2.1.2 (A:) automated matches {Rhizobium radiobacter [TaxId: 358]}
staivtnvkhfggmgsalrlseaghtvachdesfkhqdeleafaetypqlipmseqepve
lieavtsalghvdilvsndiapvewrpidkyavedyrdmvealqikpfalanavasqmkr
rksghiifitsaasfgpwkelstyasaragasalanalskelgehnipvfaiapngvdsg
dspyyypsepwktspehvawvrkytalqrlgtqkelgelvtflasgscdyltgqvfwlag
gfpvverwp

Timeline for d4ixta_:

• d4ixta_ first appeared in SCOPe 2.03
  
• d4ixta_ appears in SCOPe 2.05
  
• d4ixta_ appears in SCOPe 2.07
  
• d4ixta_ appears in the current release, SCOPe 2.08