Lineage for d4ixkd_ (4ixk D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2702136Protein Non-hem ferritin [63524] (7 species)
  7. 2702162Species Pseudo-nitzschia multiseries [TaxId:37319] [188675] (9 PDB entries)
  8. 2702202Domain d4ixkd_: 4ixk D: [223462]
    automated match to d3e6sa_
    complexed with fe

Details for d4ixkd_

PDB Entry: 4ixk (more details), 2.1 Å

PDB Description: anaerobic crystal structure of iron soaked (2 h) ferritin from pseudo- nitzschia multiseries
PDB Compounds: (D:) Ferritin

SCOPe Domain Sequences for d4ixkd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ixkd_ a.25.1.1 (D:) Non-hem ferritin {Pseudo-nitzschia multiseries [TaxId: 37319]}
seelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfan
krnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafl
npfhlqqvneedkigsilakvtdenrtpgllrsldvvs

SCOPe Domain Coordinates for d4ixkd_:

Click to download the PDB-style file with coordinates for d4ixkd_.
(The format of our PDB-style files is described here.)

Timeline for d4ixkd_: