Lineage for d4ixkb_ (4ixk B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1264121Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1264122Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1264123Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1264887Protein Non-hem ferritin [63524] (5 species)
  7. 1264899Species Pseudo-nitzschia multiseries [TaxId:37319] [188675] (9 PDB entries)
  8. 1264945Domain d4ixkb_: 4ixk B: [223460]
    automated match to d3e6sa_
    complexed with fe

Details for d4ixkb_

PDB Entry: 4ixk (more details), 2.1 Å

PDB Description: anaerobic crystal structure of iron soaked (2 h) ferritin from pseudo- nitzschia multiseries
PDB Compounds: (B:) Ferritin

SCOPe Domain Sequences for d4ixkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ixkb_ a.25.1.1 (B:) Non-hem ferritin {Pseudo-nitzschia multiseries [TaxId: 37319]}
seelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfan
krnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafl
npfhlqqvneedkigsilakvtdenrtpgllrsldvvs

SCOPe Domain Coordinates for d4ixkb_:

Click to download the PDB-style file with coordinates for d4ixkb_.
(The format of our PDB-style files is described here.)

Timeline for d4ixkb_: