SCOPe 2.06: Domain d4kbpb1: 4kbp B:9-120

Lineage for d4kbpb1 (4kbp B:9-120)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.12: Purple acid phosphatase, N-terminal domain [49363] (2 families)

5. Family b.1.12.1: Purple acid phosphatase, N-terminal domain [49364] (1 protein)

6. Protein Purple acid phosphatase, N-terminal domain [49365] (2 species)

7. Species French bean (Phaseolus vulgaris) [TaxId:3885] [49366] (3 PDB entries)

8. Domain d4kbpb1: 4kbp B:9-120 [22346]
   Other proteins in same PDB: d4kbpa2, d4kbpb2, d4kbpc2, d4kbpd2
   complexed with fe, nag, po4, zn

Details for d4kbpb1

PDB Entry: 4kbp, 2.7 Å

PDB Description: kidney bean purple acid phosphatase

PDB Compounds: (B:) purple acid phosphatase

SCOPe Domain Sequences for d4kbpb1:

Sequence; same for both SEQRES and ATOM records:

>d4kbpb1 b.1.12.1 (B:9-120) Purple acid phosphatase, N-terminal domain {French bean (Phaseolus vulgaris) [TaxId: 3885]}
rdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrkr
iakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitpp

Timeline for d4kbpb1:

• d4kbpb1 first appeared (with stable ids) in SCOP 1.55
  
• d4kbpb1 appears in SCOPe 2.05
  
• d4kbpb1 appears in SCOPe 2.07
  
• d4kbpb1 appears in the current release, SCOPe 2.08