Lineage for d4ixca2 (4ixc A:219-459)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460924Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2460925Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2462168Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2462169Protein automated matches [226839] (53 species)
    not a true protein
  7. 2462308Species Human (Homo sapiens) [TaxId:9606] [224896] (58 PDB entries)
  8. 2462330Domain d4ixca2: 4ixc A:219-459 [223458]
    automated match to d1bdga2
    complexed with 1jd, glc, na

Details for d4ixca2

PDB Entry: 4ixc (more details), 2 Å

PDB Description: Crystal structure of Human Glucokinase in complex with a small molecule activator.
PDB Compounds: (A:) Glucokinase isoform 3

SCOPe Domain Sequences for d4ixca2:

Sequence, based on SEQRES records: (download)

>d4ixca2 c.55.1.0 (A:219-459) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qcevgmivgtgcnacymeemqnvelvegdegrmcvntewgafgdsgeldeflleydrlvd
essanpgqqlyekliggkymgelvrlvllrlvdenllfhgeaseqlrtrgafetrfvsqv
esdtgdrkqiynilstlglrpsttdcdivrracesvstraahmcsaglagvinrmresrs
edvmritvgvdgsvyklhpsfkerfhasvrrltpsceitfieseegsgrgaalvsavack
k

Sequence, based on observed residues (ATOM records): (download)

>d4ixca2 c.55.1.0 (A:219-459) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qcevgmivgtgcnacymeemqnvelvegdegrmcvntewgafgdsgeldeflleydrlvd
essanpgqqlyekliggkymgelvrlvllrlvdenllfhgeaseqlrtrgafetrfvsqv
esdgdrkqiynilstlglrpsttdcdivrracesvstraahmcsaglagvinrmresrse
dvmritvgvdgsvyklhpsfkerfhasvrrltpsceitfieseegsgrgaalvsavackk

SCOPe Domain Coordinates for d4ixca2:

Click to download the PDB-style file with coordinates for d4ixca2.
(The format of our PDB-style files is described here.)

Timeline for d4ixca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ixca1