Lineage for d4ix0a_ (4ix0 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2435328Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2435860Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins)
  6. 2436016Protein automated matches [190053] (10 species)
    not a true protein
  7. 2436055Species Sulfolobus solfataricus [TaxId:2287] [190005] (9 PDB entries)
  8. 2436066Domain d4ix0a_: 4ix0 A: [223456]
    automated match to d1a53a_
    complexed with ni, so4

Details for d4ix0a_

PDB Entry: 4ix0 (more details), 2.5 Å

PDB Description: computational design of an unnatural amino acid metalloprotein with atomic level accuracy
PDB Compounds: (A:) Unnatural Amino Acid Mediated Metalloprotein

SCOPe Domain Sequences for d4ix0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ix0a_ c.1.2.4 (A:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
prylkgwledvvqlslrrpsvrasrqrpiislnerilefnkrnitaiiaeykrkspsgld
verdpieyakfmeryavglsilteekyfngsyetlrkiassvsipilmmdfivkesqidd
aynlgadtvllxvkiltereleslleyarsygmeplieitdendldialrigarfigiss
qddetleinkenqrklismipsnvvkvadsgiserneieelrklgvnafligsslmrnpe
kikelil

SCOPe Domain Coordinates for d4ix0a_:

Click to download the PDB-style file with coordinates for d4ix0a_.
(The format of our PDB-style files is described here.)

Timeline for d4ix0a_: