SCOP 1.57: Domain d4kbpa1: 4kbp A:9-120

Lineage for d4kbpa1 (4kbp A:9-120)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.12: Purple acid phosphatase, N-terminal domain [49363] (1 family)

5. Family b.1.12.1: Purple acid phosphatase, N-terminal domain [49364] (1 protein)

6. Protein Purple acid phosphatase, N-terminal domain [49365] (1 species)

7. Species Kidney bean (Phaseolus vulgaris) [TaxId:3885] [49366] (3 PDB entries)

8. Domain d4kbpa1: 4kbp A:9-120 [22345]
   Other proteins in same PDB: d4kbpa2, d4kbpb2, d4kbpc2, d4kbpd2

Details for d4kbpa1

PDB Entry: 4kbp, 2.7 Å

PDB Description: kidney bean purple acid phosphatase

SCOP Domain Sequences for d4kbpa1:

Sequence; same for both SEQRES and ATOM records:

>d4kbpa1 b.1.12.1 (A:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris)}
rdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrkr
iakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitpp

Timeline for d4kbpa1:

• d4kbpa1 first appeared (with stable ids) in SCOP 1.55
  
• d4kbpa1 appears in SCOP 1.59
  
• d4kbpa1 appears in the current release, SCOPe 2.08