SCOPe 2.05: Domain d3mspb_: 3msp B:

Lineage for d3mspb_ (3msp B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.11: PapD-like [49354] (3 families)
   contains PP switch between strands D and C'

5. Family b.1.11.2: MSP-like [49360] (4 proteins)
   Pfam PF00635

6. Protein Major sperm protein, MSP [49361] (2 species)

7. Species Pig roundworm (Ascaris suum), alpha isoform [TaxId:6253] [49362] (4 PDB entries)

8. Domain d3mspb_: 3msp B: [22344]

Details for d3mspb_

PDB Entry: 3msp

PDB Description: motile major sperm protein (msp) of ascaris suum, nmr, 20 structures

PDB Compounds: (B:) major sperm protein

SCOPe Domain Sequences for d3mspb_:

Sequence; same for both SEQRES and ATOM records:

>d3mspb_ b.1.11.2 (B:) Major sperm protein, MSP {Pig roundworm (Ascaris suum), alpha isoform [TaxId: 6253]}
aqsvppgdintqpsqkivfnapyddkhtyhikitnaggrrigwaikttnmrrlsvdppcg
vldpkekvlmavscdtfnaatedlnndritiewtntpdgaakqfrrewfqgdgmvrrknl
pieynl

Timeline for d3mspb_:

• d3mspb_ first appeared (with stable ids) in SCOP 1.55
  
• d3mspb_ appears in SCOPe 2.04
  
• d3mspb_ appears in SCOPe 2.06
  
• d3mspb_ appears in the current release, SCOPe 2.08