SCOP 1.57: Domain d3mspb_: 3msp B:

Lineage for d3mspb_ (3msp B:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.11: PapD-like [49354] (2 families)

5. Family b.1.11.2: Major sperm protein, alpha isoform (recombinant), ph 4.6 [49360] (1 protein)

6. Protein Major sperm protein, alpha isoform (recombinant), ph 4.6 [49361] (1 species)

7. Species Pig roundworm (Ascaris suum) [TaxId:6253] [49362] (3 PDB entries)

8. Domain d3mspb_: 3msp B: [22344]

Details for d3mspb_

PDB Entry: 3msp

PDB Description: motile major sperm protein (msp) of ascaris suum, nmr, 20 structures

SCOP Domain Sequences for d3mspb_:

Sequence; same for both SEQRES and ATOM records:

>d3mspb_ b.1.11.2 (B:) Major sperm protein, alpha isoform (recombinant), ph 4.6 {Pig roundworm (Ascaris suum)}
aqsvppgdintqpsqkivfnapyddkhtyhikitnaggrrigwaikttnmrrlsvdppcg
vldpkekvlmavscdtfnaatedlnndritiewtntpdgaakqfrrewfqgdgmvrrknl
pieynl

Timeline for d3mspb_:

• d3mspb_ first appeared (with stable ids) in SCOP 1.55
  
• d3mspb_ appears in SCOP 1.59
  
• d3mspb_ appears in the current release, SCOPe 2.08