SCOPe 2.03: Domain d4iw9b1: 4iw9 B:-5-80

Lineage for d4iw9b1 (4iw9 B:-5-80)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (107 species)
   not a true protein

7. Species Mannheimia haemolytica [TaxId:272629] [226567] (2 PDB entries)

8. Domain d4iw9b1: 4iw9 B:-5-80 [223436]
   Other proteins in same PDB: d4iw9a2, d4iw9b2, d4iw9c2
   automated match to d2pmta2
   complexed with act, cl, gsh, pge

Details for d4iw9b1

PDB Entry: 4iw9, 1.76 Å

PDB Description: Crystal structure of glutathione s-transferase mha_0454 (target efi-507015) from mannheimia haemolytica, gsh complex

PDB Compounds: (B:) glutathione transferase

SCOPe Domain Sequences for d4iw9b1:

Sequence; same for both SEQRES and ATOM records:

>d4iw9b1 c.47.1.0 (B:-5-80) automated matches {Mannheimia haemolytica [TaxId: 272629]}
nlyfqsmklygltgacsfvphvalewvklranqdyafqavsrefiksaeylalnprgnvp
llvdgdlaltqnqaivhyldelypea

Timeline for d4iw9b1:

• d4iw9b1 is new in SCOPe 2.03-stable
  
• d4iw9b1 appears in SCOPe 2.04
  
• d4iw9b1 appears in the current release, SCOPe 2.08