![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
![]() | Protein automated matches [226831] (73 species) not a true protein |
![]() | Species Mannheimia haemolytica [TaxId:272629] [226568] (2 PDB entries) |
![]() | Domain d4iw9a2: 4iw9 A:81-209 [223435] Other proteins in same PDB: d4iw9a1, d4iw9a3, d4iw9b1, d4iw9b3, d4iw9c1, d4iw9c3 automated match to d2pmta1 complexed with act, cl, gsh, pge |
PDB Entry: 4iw9 (more details), 1.76 Å
SCOPe Domain Sequences for d4iw9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4iw9a2 a.45.1.0 (A:81-209) automated matches {Mannheimia haemolytica [TaxId: 272629]} klfgsktardkakaarwlaffnsdvhksfvplfrlpsyaegnetltktirqqsaeqileq lafanahlenhiffgeeisvadaylyimlnwcrllgldfshlsqlsafmqrveadqgvdn vreqeglkg
Timeline for d4iw9a2: