Lineage for d4iw9a2 (4iw9 A:81-209)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2714075Species Mannheimia haemolytica [TaxId:272629] [226568] (2 PDB entries)
  8. 2714076Domain d4iw9a2: 4iw9 A:81-209 [223435]
    Other proteins in same PDB: d4iw9a1, d4iw9a3, d4iw9b1, d4iw9b3, d4iw9c1, d4iw9c3
    automated match to d2pmta1
    complexed with act, cl, gsh, pge

Details for d4iw9a2

PDB Entry: 4iw9 (more details), 1.76 Å

PDB Description: Crystal structure of glutathione s-transferase mha_0454 (target efi-507015) from mannheimia haemolytica, gsh complex
PDB Compounds: (A:) glutathione transferase

SCOPe Domain Sequences for d4iw9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iw9a2 a.45.1.0 (A:81-209) automated matches {Mannheimia haemolytica [TaxId: 272629]}
klfgsktardkakaarwlaffnsdvhksfvplfrlpsyaegnetltktirqqsaeqileq
lafanahlenhiffgeeisvadaylyimlnwcrllgldfshlsqlsafmqrveadqgvdn
vreqeglkg

SCOPe Domain Coordinates for d4iw9a2:

Click to download the PDB-style file with coordinates for d4iw9a2.
(The format of our PDB-style files is described here.)

Timeline for d4iw9a2: