Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (195 species) not a true protein |
Species Mannheimia haemolytica [TaxId:272629] [226567] (2 PDB entries) |
Domain d4iw9a1: 4iw9 A:1-80 [223434] Other proteins in same PDB: d4iw9a2, d4iw9a3, d4iw9b2, d4iw9b3, d4iw9c2, d4iw9c3 automated match to d2pmta2 complexed with act, cl, gsh, pge |
PDB Entry: 4iw9 (more details), 1.76 Å
SCOPe Domain Sequences for d4iw9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4iw9a1 c.47.1.0 (A:1-80) automated matches {Mannheimia haemolytica [TaxId: 272629]} mklygltgacsfvphvalewvklranqdyafqavsrefiksaeylalnprgnvpllvdgd laltqnqaivhyldelypea
Timeline for d4iw9a1: