Lineage for d3mspa_ (3msp A:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 161647Superfamily b.1.11: PapD-like [49354] (2 families) (S)
  5. 161688Family b.1.11.2: Major sperm protein [49360] (1 protein)
  6. 161689Protein Major sperm protein [49361] (2 species)
  7. 161695Species Pig roundworm (Ascaris suum), alpha isoform [TaxId:6253] [49362] (3 PDB entries)
  8. 161706Domain d3mspa_: 3msp A: [22343]

Details for d3mspa_

PDB Entry: 3msp (more details)

PDB Description: motile major sperm protein (msp) of ascaris suum, nmr, 20 structures

SCOP Domain Sequences for d3mspa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mspa_ b.1.11.2 (A:) Major sperm protein {Pig roundworm (Ascaris suum), alpha isoform}
aqsvppgdintqpsqkivfnapyddkhtyhikitnaggrrigwaikttnmrrlsvdppcg
vldpkekvlmavscdtfnaatedlnndritiewtntpdgaakqfrrewfqgdgmvrrknl
pieynl

SCOP Domain Coordinates for d3mspa_:

Click to download the PDB-style file with coordinates for d3mspa_.
(The format of our PDB-style files is described here.)

Timeline for d3mspa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3mspb_