Class a: All alpha proteins [46456] (284 folds) |
Fold a.144: PABP domain-like [63569] (2 superfamilies) 4 helices; an orthogonal array |
Superfamily a.144.1: PABC (PABP) domain [63570] (1 family) |
Family a.144.1.1: PABC (PABP) domain [63571] (3 proteins) |
Protein automated matches [191271] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226585] (2 PDB entries) |
Domain d4ived_: 4ive D: [223427] automated match to d1jh4a_ complexed with cl |
PDB Entry: 4ive (more details), 2.3 Å
SCOPe Domain Sequences for d4ived_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ived_ a.144.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} etltasrlasappqkqkqmlgerlfpliqamhptlagkitgmlleidnsellymlespes lrskvdeavavlqahq
Timeline for d4ived_: