Lineage for d4ived_ (4ive D:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1284194Fold a.144: PABP domain-like [63569] (2 superfamilies)
    4 helices; an orthogonal array
  4. 1284195Superfamily a.144.1: PABC (PABP) domain [63570] (1 family) (S)
  5. 1284196Family a.144.1.1: PABC (PABP) domain [63571] (3 proteins)
  6. 1284209Protein automated matches [191271] (2 species)
    not a true protein
  7. 1284210Species Human (Homo sapiens) [TaxId:9606] [226585] (2 PDB entries)
  8. 1284214Domain d4ived_: 4ive D: [223427]
    automated match to d1jh4a_
    complexed with cl

Details for d4ived_

PDB Entry: 4ive (more details), 2.3 Å

PDB Description: crystal structure of a polyadenylate-binding protein 3 (pabpc3) from homo sapiens at 2.30 a resolution
PDB Compounds: (D:) Polyadenylate-binding protein 3

SCOPe Domain Sequences for d4ived_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ived_ a.144.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
etltasrlasappqkqkqmlgerlfpliqamhptlagkitgmlleidnsellymlespes
lrskvdeavavlqahq

SCOPe Domain Coordinates for d4ived_:

Click to download the PDB-style file with coordinates for d4ived_.
(The format of our PDB-style files is described here.)

Timeline for d4ived_: