Lineage for d4ivea_ (4ive A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734855Fold a.144: PABP domain-like [63569] (2 superfamilies)
    4 helices; an orthogonal array
  4. 2734856Superfamily a.144.1: PABC (PABP) domain [63570] (2 families) (S)
  5. 2734857Family a.144.1.1: PABC (PABP) domain [63571] (3 proteins)
  6. 2734870Protein automated matches [191271] (2 species)
    not a true protein
  7. 2734871Species Human (Homo sapiens) [TaxId:9606] [226585] (4 PDB entries)
  8. 2734880Domain d4ivea_: 4ive A: [223424]
    automated match to d1jh4a_
    complexed with cl

Details for d4ivea_

PDB Entry: 4ive (more details), 2.3 Å

PDB Description: crystal structure of a polyadenylate-binding protein 3 (pabpc3) from homo sapiens at 2.30 a resolution
PDB Compounds: (A:) Polyadenylate-binding protein 3

SCOPe Domain Sequences for d4ivea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ivea_ a.144.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qetltasrlasappqkqkqmlgerlfpliqamhptlagkitgmlleidnsellymlespe
slrskvdeavavlqah

SCOPe Domain Coordinates for d4ivea_:

Click to download the PDB-style file with coordinates for d4ivea_.
(The format of our PDB-style files is described here.)

Timeline for d4ivea_: