SCOPe 2.06: Domain d4iv6b2: 4iv6 B:227-384

Lineage for d4iv6b2 (4iv6 B:227-384)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families)
   multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel

5. Family a.29.3.0: automated matches [227204] (1 protein)
   not a true family

6. Protein automated matches [226935] (26 species)
   not a true protein

7. Species Mycobacterium smegmatis [TaxId:246196] [226168] (3 PDB entries)

8. Domain d4iv6b2: 4iv6 B:227-384 [223420]
   Other proteins in same PDB: d4iv6a1, d4iv6b1
   automated match to d1ukwa1
   complexed with fda

Details for d4iv6b2

PDB Entry: 4iv6, 2 Å

PDB Description: x-ray crystal structure of an isovaleryl-coa dehydrogenase from mycobacterium smegmatis

PDB Compounds: (B:) Acyl-CoA dehydrogenase FadE3

SCOPe Domain Sequences for d4iv6b2:

Sequence; same for both SEQRES and ATOM records:

>d4iv6b2 a.29.3.0 (B:227-384) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
egrgfaqmmkglevgrlqvaaratgvaraafedalrysqeresfgkpiwqhqsvgnmlad
mgtklyaarslllsaaekfdagqrcdmeagmaklfasetamqialdavrvhggygystey
dveryfrdaplmivgegtneiqrnviakqlvarggldi

Timeline for d4iv6b2:

• d4iv6b2 first appeared in SCOPe 2.03
  
• d4iv6b2 appears in SCOPe 2.05
  
• d4iv6b2 appears in SCOPe 2.07
  
• d4iv6b2 appears in the current release, SCOPe 2.08