Lineage for d4iv6b2 (4iv6 B:227-384)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2708344Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 2708478Family a.29.3.0: automated matches [227204] (1 protein)
    not a true family
  6. 2708479Protein automated matches [226935] (30 species)
    not a true protein
  7. 2708612Species Mycobacterium smegmatis [TaxId:246196] [226168] (3 PDB entries)
  8. 2708619Domain d4iv6b2: 4iv6 B:227-384 [223420]
    Other proteins in same PDB: d4iv6a1, d4iv6b1
    automated match to d1ukwa1
    complexed with fda

Details for d4iv6b2

PDB Entry: 4iv6 (more details), 2 Å

PDB Description: x-ray crystal structure of an isovaleryl-coa dehydrogenase from mycobacterium smegmatis
PDB Compounds: (B:) Acyl-CoA dehydrogenase FadE3

SCOPe Domain Sequences for d4iv6b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iv6b2 a.29.3.0 (B:227-384) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
egrgfaqmmkglevgrlqvaaratgvaraafedalrysqeresfgkpiwqhqsvgnmlad
mgtklyaarslllsaaekfdagqrcdmeagmaklfasetamqialdavrvhggygystey
dveryfrdaplmivgegtneiqrnviakqlvarggldi

SCOPe Domain Coordinates for d4iv6b2:

Click to download the PDB-style file with coordinates for d4iv6b2.
(The format of our PDB-style files is described here.)

Timeline for d4iv6b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4iv6b1