SCOPe 2.04: Domain d4iv6b1: 4iv6 B:2-226

Lineage for d4iv6b1 (4iv6 B:2-226)

1. Root: SCOPe 2.04

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
   2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology

4. Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families)
   flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)

5. Family e.6.1.0: automated matches [227203] (1 protein)
   not a true family

6. Protein automated matches [226934] (17 species)
   not a true protein

7. Species Mycobacterium smegmatis [TaxId:246196] [226167] (3 PDB entries)

8. Domain d4iv6b1: 4iv6 B:2-226 [223419]
   Other proteins in same PDB: d4iv6a2, d4iv6b2
   automated match to d1ukwa2
   complexed with fda

Details for d4iv6b1

PDB Entry: 4iv6, 2 Å

PDB Description: x-ray crystal structure of an isovaleryl-coa dehydrogenase from mycobacterium smegmatis

PDB Compounds: (B:) Acyl-CoA dehydrogenase FadE3

SCOPe Domain Sequences for d4iv6b1:

Sequence; same for both SEQRES and ATOM records:

>d4iv6b1 e.6.1.0 (B:2-226) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
altaeeetivktvhdfvekqvkpvvrelehantypeelietmkeigifglaipepygfga
vsmpcyvqvaeelargwmslagamgghtvvskllllfgteeqkqkylprmatgelratma
ltepgggsdlqamrtvarrdgddyvingsktwisnarrsdlvalmcktdpdaqpahkgvs
illvekvpgfdvsrdlpklgykgvescelnftdarvpvssllgdd

Timeline for d4iv6b1:

• d4iv6b1 first appeared in SCOPe 2.03
  
• d4iv6b1 appears in SCOPe 2.05
  
• d4iv6b1 appears in the current release, SCOPe 2.08